General Information

  • ID:  hor006670
  • Uniprot ID:  Q7ZZY8
  • Protein name:  Urophysin beta
  • Gene name:  uts2b
  • Organism:  Danio rerio (Zebrafish) (Brachydanio rerio)
  • Family:  Urotensin-2 family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Danio (genus), Danioninae (subfamily), Danionidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi , Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HPVVQSAEMSFGRPVVVEEEQALNPEELSFSEQAYLSHDAAGFGYPSLISGDISSDGLRTAGFVPSQAVKEALLEKPLWSRFLGS
  • Length:  85
  • Propeptide:  MMWKLLLLFALLLTVLEPLLGHPVVQSAEMSFGRPVVVEEEQALNPEELSFSEQAYLSHDAAGFGYPSLISGDISSDGLRTAGFVPSQAVKEALLEKPLWSRFLGSRKQYHKRGSNTECFWKYCV
  • Signal peptide:  MMWKLLLLFALLLTVLEPLLG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Urotensin is found in the teleost caudal neurosecretory system. It has a suggested role in osmoregulation and as a corticotropin-releasing factor (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  UTS2R
  • Target Unid:  E7F7E1
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q7ZZY8-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006670_AF2.pdbhor006670_ESM.pdb

Physical Information

Mass: 1066465 Formula: C411H628N106O130S
Absent amino acids: C Common amino acids: S
pI: 4.23 Basic residues: 7
Polar residues: 23 Hydrophobic residues: 32
Hydrophobicity: -12.35 Boman Index: -10204
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 83.76
Instability Index: 6456.35 Extinction Coefficient cystines: 8480
Absorbance 280nm: 100.95

Literature

  • PubMed ID:  NA
  • Title:  NA